PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00014.1.g05440.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 349aa    MW: 35880.8 Da    PI: 9.2816
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00014.1.g05440.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.6e-3855111359
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                   ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk +
  Zjn_sc00014.1.g05440.1.sm.mk  55 QTPLRCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPR 111
                                   66789**************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.1E-3157110IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2558109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09658112IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106096IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MDQLKSVNDG NPTPLPMLLH PVVSNPSPTS SSSTSSRSST SSPKGQGQGQ GAAEQTPLRC  60
PRCNSSNTKF CYYNNYNLTQ PRHFCKTCRR YWTKGGALRN VPIGGGCRKP RPIPMPAAKP  120
AISCKAGGVG PQLGLGVGMG MGGASPVPWA SSQQAAAAQL MALLNSARNV QGHGGSNVHR  180
LLGLDTMGHL PLHVLPGGPG AGNVAGVPAS LWPLSAPRQV PATPAHMDSQ LGMSPLGHHD  240
MLSNLGIKLP PSSASPAPSY YSDQLHAVMS NAGHPHEYDV ASTTSLPCTT AVTSLPPAIS  300
SVSAALSSAT AGLDLPPVSL SAPEMQYWTG PAAMSVAWPD LTTPNGAFP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981654.11e-146PREDICTED: uncharacterized protein LOC101786956
TrEMBLK4ALA51e-146K4ALA5_SETIT; Uncharacterized protein
STRINGSi039685m1e-145(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.18e-32Dof family protein